PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678458613
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family NF-YB
Protein Properties Length: 417aa    MW: 45469.8 Da    PI: 7.3727
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678458613genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB179.62.7e-5673168297
      NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                reqdrflPianv+rimkk lPanakiskdaketvqecvsefisfvt+easdkcqrekrkt+ngddllwa+ tlGf++yveplkvyl kyre+egek
  678458613  73 REQDRFLPIANVGRIMKKGLPANAKISKDAKETVQECVSEFISFVTGEASDKCQREKRKTVNGDDLLWAMMTLGFDEYVEPLKVYLGKYREMEGEK 168
                89*******************************************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.2E-5069173IPR009072Histone-fold
SuperFamilySSF471131.43E-3875173IPR009072Histone-fold
PfamPF008088.1E-2778142IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006153.2E-19106124No hitNo description
PROSITE patternPS006850109125IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006153.2E-19125143No hitNo description
PRINTSPR006153.2E-19144162No hitNo description
PfamPF054983.0E-11350392IPR008801Rapid ALkalinization Factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
MHIFLVAISS VCQREGEVVK VIPNPLLRCD LIQKNQRSAV GVKKNLAAFA CGEKMVDSEN  60
DSGGYGNSSA GNREQDRFLP IANVGRIMKK GLPANAKISK DAKETVQECV SEFISFVTGE  120
ASDKCQREKR KTVNGDDLLW AMMTLGFDEY VEPLKVYLGK YREMEGEKIS SGGSEEGGAA  180
VIGAGIYGGN VMDYHEPGHI YGVPGASDVL QHVHGAGATH GLVGKRKRTD APTWGLLARD  240
TIGGIVPCPI SKISPSLVTC SAAPRAYSSN CRGARSNVMQ SWLMMVTSQS FQLLLRSLSN  300
NLLCWEHESC SDRYILPNCV PFIQCCIVFT VGSPCSRPFP WCLIGDDSDA IMPTDVSHRM  360
LAQSGDYIGY GALGRDSVPC SRTGRSYYNG DSHQPQSLQL GIYQDHVLRS KQQLIDW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B3e-4373163292Transcription factor HapC (Eurofung)
4g92_B3e-4373163292Transcription factor HapC (Eurofung)
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.12e-62nuclear factor Y, subunit B3